PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G251500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 474aa    MW: 50178.5 Da    PI: 5.2628
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G251500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS411.86.3e-126744471374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                         lv+lL++cA av++gd++ a+a La  +    a + g+ + R+a +ft AL++rl+     + +  pp++++ +  +++++ ++ f+e+ P
  Sevir.5G251500.1.p  74 LVHLLMSCAGAVEAGDHAGASAHLADAHAAlaAVSPGSGIGRVAVHFTAALSRRLFP---PTPSPPPPQPAAADADADHAFLYHHFYEAGP 161
                         68***********************999887788889*******************9...667788999999899**************** PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                         +lkf+h+taNqaIleav+g+++vHiiDf+++qGlQWpaL+qaLa Rp+gpp lR+Tg+g+p++  ++ l+ +g rLa++A++++v+f+f+ 
  Sevir.5G251500.1.p 162 YLKFAHFTANQAILEAVQGCKHVHIIDFNLMQGLQWPALIQALALRPGGPPFLRLTGIGPPSPPGRDDLRDVGVRLADLARSVRVHFSFRG 252
                         ******************************************************************************************* PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysal 267
                         ++a+rl+++++++L+v++gEa+aVn+vlqlhrl++++ + ++    ++d+vL++v s++P+v++vveqeadhn++ Fl+rf+eal yysa+
  Sevir.5G251500.1.p 253 VAANRLDEIRPWMLQVSQGEAVAVNSVLQLHRLVADPSAAADdaraPIDAVLDCVSSMRPRVFTVVEQEADHNKPGFLDRFTEALFYYSAV 343
                         **********************************99988877777889******************************************* PP

                GRAS 268 fdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                         fdsl+a       +     +++l+rei+++v+ egaerrerhe l++Wr+rl++aG+  vpl+ +a  qa++l+  ++++g+ vee +g+l
  Sevir.5G251500.1.p 344 FDSLDAA---SGGAGDAAAEAYLEREICDIVCGEGAERRERHEPLRRWRDRLGRAGLAGVPLGANALRQARMLVGLFSGEGHCVEEADGCL 431
                         ****998...235555666777********************************************************************* PP

                GRAS 359 vlgWkdrpLvsvSaWr 374
                         +lgW++rpL+s+SaWr
  Sevir.5G251500.1.p 432 TLGWHGRPLFSASAWR 447
                         ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.89648427IPR005202Transcription factor GRAS
PfamPF035142.2E-12374447IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MAMGGAFPFQ WPAEPGLDVS LPPLPTVVPD AAGVAYYADA AADMHAAMPA VLPDFAAALA  60
AMRREEEEAA GIRLVHLLMS CAGAVEAGDH AGASAHLADA HAALAAVSPG SGIGRVAVHF  120
TAALSRRLFP PTPSPPPPQP AAADADADHA FLYHHFYEAG PYLKFAHFTA NQAILEAVQG  180
CKHVHIIDFN LMQGLQWPAL IQALALRPGG PPFLRLTGIG PPSPPGRDDL RDVGVRLADL  240
ARSVRVHFSF RGVAANRLDE IRPWMLQVSQ GEAVAVNSVL QLHRLVADPS AAADDARAPI  300
DAVLDCVSSM RPRVFTVVEQ EADHNKPGFL DRFTEALFYY SAVFDSLDAA SGGAGDAAAE  360
AYLEREICDI VCGEGAERRE RHEPLRRWRD RLGRAGLAGV PLGANALRQA RMLVGLFSGE  420
GHCVEEADGC LTLGWHGRPL FSASAWRAEE NNHSDSNADG SSGSEESNIS CSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-57744474375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9698160.0EU969816.1 Zea mays clone 336035 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969307.10.0PREDICTED: DELLA protein DWARF8-like
SwissprotQ9LQT81e-131GAI_ARATH; DELLA protein GAI
TrEMBLK3XHC20.0K3XHC2_SETIT; Uncharacterized protein
STRINGSi001293m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-100GRAS family protein